PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.7G224500.1.p
Common NameSETIT_011853mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRF
Protein Properties Length: 374aa    MW: 39984.9 Da    PI: 8.8167
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.7G224500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.72.4e-24107151145
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         d+epgrCrRtDGKkWRC +++ +++k+CErH+hrgr+rsrk++e+
  Seita.7G224500.1.p 107 DPEPGRCRRTDGKKWRCAKEAAPDSKYCERHMHRGRNRSRKPVEA 151
                         79****************************************996 PP

2QLQ61.22.9e-215287237
                 QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                        +FTaaQ ++L++Q+l+yKyL+a++PvPp+Ll++i++
  Seita.7G224500.1.p 52 PFTAAQYEELEHQALIYKYLVAGVPVPPDLLLPIRR 87
                        9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.6E-125187IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.2695287IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.2E-155286IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.773107151IPR014977WRC domain
PfamPF088798.4E-21108150IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MAMPFASLSP AADHRPSSLL PFCRAAPLSA VGEADAQQHA MMSGRWAARP VPFTAAQYEE  60
LEHQALIYKY LVAGVPVPPD LLLPIRRGFV YHQPALGYGP YFGKKVDPEP GRCRRTDGKK  120
WRCAKEAAPD SKYCERHMHR GRNRSRKPVE AQLVTPPHAQ QQPPVAAAGF QNQSLYPAVL  180
AGNGGRAGGG GGGGGGLATG TFGLGSTAQL HMDSAAAYAT ATGGGSKDLR YSAYGVRSLS  240
DEHSQLMPAA MDTSMDNSWR LLPSQTSTFQ ATSYPLFGTL SGLDESTIAS LPKTQREPLS  300
FFGSDFVTAA KQENQTLRPF FDEWPKARDS WPELGDDNSL ASFSATQLSI SIPMATSDFS  360
NTSSRSPSGI PSR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1183191GGRAGGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7278580.0KJ727858.1 Zea mays clone pUT5949 GRF transcription factor (GRF5) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976689.10.0PREDICTED: growth-regulating factor 3-like
SwissprotQ6AWY60.0GRF3_ORYSJ; Growth-regulating factor 3
TrEMBLK3YCA80.0K3YCA8_SETIT; Uncharacterized protein
STRINGSi011853m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24633476
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.14e-46growth-regulating factor 5